PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G25440.1
Common NameLOC102702125
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 236aa    MW: 25548.5 Da    PI: 4.7329
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G25440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.5e-1958111356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k+++++ eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  OB08G25440.1  58 KKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 111
                   456899***********************************************9 PP

2HD-ZIP_I/II132.91.1e-4257149193
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   ekkrrls eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktk+lE+dy+aL+++ydal++++++L++++++L +e+ke
  OB08G25440.1  57 EKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKKLERDYAALRHSYDALRADHDALRRDKDALLAEIKE 149
                   69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-1945114IPR009057Homeodomain-like
PROSITE profilePS5007117.32953113IPR001356Homeobox domain
SMARTSM003892.7E-1856117IPR001356Homeobox domain
PfamPF000462.3E-1658111IPR001356Homeobox domain
CDDcd000862.73E-1858114No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1960120IPR009057Homeodomain-like
PRINTSPR000317.4E-68493IPR000047Helix-turn-helix motif
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
PRINTSPR000317.4E-693109IPR000047Helix-turn-helix motif
PfamPF021837.9E-17113154IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MRRPSDCGGG GSGGGSPASL LPMVADGDGF GGVGMEEEMD GDEDMVMCGR GGGGAGEKKR  60
RLSVEQVRAL ERSFEVENKL EPERKARLAR DLGLQPRQVA VWFQNRRARW KTKKLERDYA  120
ALRHSYDALR ADHDALRRDK DALLAEIKEL KGKLGDEDAA EGFSPAAVGA AVASEEAVTG  180
ALLHHAEVFF HGQLLKVDDD EAAFLGDDGA ACGGFFADEH LPSLPWWAEP AEQWTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18288ERKARLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0682441e-162AK068244.1 Oryza sativa Japonica Group cDNA clone:J013140I04, full insert sequence.
GenBankAK1068181e-162AK106818.1 Oryza sativa Japonica Group cDNA clone:002-116-D05, full insert sequence.
GenBankCT8294461e-162CT829446.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA031N19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660223.11e-169PREDICTED: homeobox-leucine zipper protein HOX20-like
SwissprotQ6Z2481e-117HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
SwissprotA2YWC01e-117HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
TrEMBLJ3MTW31e-169J3MTW3_ORYBR; Uncharacterized protein
STRINGOB08G25440.11e-168(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.26e-46homeobox protein 5